LRRN3 anticorps (N-Term)

N° du produit ABIN634977

Cet anticorps anti-LRRN3 est un anticorps Lapin Polyclonal détectant LRRN3 dans WB. Adapté pour Humain.

Aperçu rapide pour LRRN3 anticorps (N-Term) (ABIN634977)

Antigène: LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRN3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRRN3 anticorps

Épitope: N-Term

Specificité: LRRN3 antibody was raised against the N terminal of LRRN3

Purification: Affinity purified

Immunogène: LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRN3 Blocking Peptide, (ABIN937968), is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRN3

Antigène: LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))

Autre désignation: LRRN3

Sujet: LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.

Poids moléculaire: 79 kDa (MW of target protein)